PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN20621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 296aa    MW: 31555 Da    PI: 7.1472
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN20621.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.8e-121155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      W++e d+ + +a + ++ +   +W++Ia+ ++ g+tl+++k+++ 
       KHN20621.1 11 QWSKEQDKAFENALAIHPEDasdRWEKIAADVP-GKTLEEIKHHYE 55
                     7********************************.**********96 PP

2Myb_DNA-binding43.85.9e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
       KHN20621.1 122 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.217762IPR017884SANT domain
SMARTSM007171.7E-9860IPR001005SANT/Myb domain
SuperFamilySSF466892.83E-111066IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-51156IPR009057Homeodomain-like
PfamPF002491.0E-91155IPR001005SANT/Myb domain
CDDcd001674.78E-101258No hitNo description
PROSITE profilePS5129417.61114171IPR017930Myb domain
SuperFamilySSF466898.28E-17117172IPR009057Homeodomain-like
SMARTSM007174.5E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.5E-17119169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.2E-11122165IPR009057Homeodomain-like
PfamPF002497.4E-12122166IPR001005SANT/Myb domain
CDDcd001671.29E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTVDEVGSSS QWSKEQDKAF ENALAIHPED ASDRWEKIAA DVPGKTLEEI KHHYELLVED  60
VSQIESGYVP LPSYNSSPEG STSHASEEGA GKKGGHSWNS NNESNHGTKA SRSDQERRKG  120
IAWTEDEHRL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVNN GDVSAPQGPI TGQTNGSADN SAGKSTKPAP PAPTAALGVG IYAGPTIGQP  240
IGGPLVSAVG TPVMNLPPPA HMAYGLGAPV PGAVVPGAPM NLGPVPYPMP HTSARR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-20777676RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966930.0BT096693.1 Soybean clone JCVI-FLGm-25B10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001240091.10.0uncharacterized protein LOC100819797
RefseqXP_014625729.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_006601855.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_014625728.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_014625727.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_014625726.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_014625725.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_014625724.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
RefseqXP_014625723.10.0PREDICTED: uncharacterized protein LOC100819797 isoform X1
SwissprotQ8S9H71e-64DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2QGG10.0A0A0B2QGG1_GLYSO; Transcription factor MYB1R1
TrEMBLC6TGE30.0C6TGE3_SOYBN; Uncharacterized protein
STRINGGLYMA18G18140.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-117MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]